PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_10241_BGI-A2_v1.0
Common NameF383_02109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 201aa    MW: 22084.4 Da    PI: 9.9927
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_10241_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.51.9e-32106162158
                   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                 +ep++VNaKQy++Il+RRq+Rak+e+e+k  +ksrkpylheSRh hAlrR+RgsgGrF
  Cotton_A_10241_BGI-A2_v1.0 106 EEPVFVNAKQYHGILRRRQSRAKAESENKA-IKSRKPYLHESRHLHALRRARGSGGRF 162
                                 69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.0E-36104165IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.834105165IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-27107162IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.6E-24108130IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860110130IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.6E-24139162IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MPREAPKNDN EIGEQQKHSE PHNQSSSPAT GLSPSAITTP NIPYTTSQHA VAPATYPYPD  60
PYYRSIFAPY DAQPYPPQPY GGQPMVHLQL MGIQQAGVPL PSGAVEEPVF VNAKQYHGIL  120
RRRQSRAKAE SENKAIKSRK PYLHESRHLH ALRRARGSGG RFLNSKKNES KQNDAASGDK  180
SQSNINLNSN KSEVSSVEGT S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-22105170166NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4721775e-53AM472177.2 Vitis vinifera contig VV78X243821.10, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443082.11e-119PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443083.11e-119PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443084.11e-119PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443085.11e-119PREDICTED: nuclear transcription factor Y subunit A-7-like
SwissprotQ84JP18e-68NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A0B0MDY51e-140A0A0B0MDY5_G
STRINGVIT_10s0003g04650.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41682756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.22e-53nuclear factor Y, subunit A7